DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9344 and LOC100360750

DIOPT Version :9

Sequence 1:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_017454452.1 Gene:LOC100360750 / 100360750 RGDID:2321508 Length:80 Species:Rattus norvegicus


Alignment Length:77 Identity:66/77 - (85%)
Similarity:70/77 - (90%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGN 67
            ||:..|.|:.||.||||.||||:|||||||||||||||||.||||||||||||||||||||||||
  Rat     4 RKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGN 68

  Fly    68 NVLYISTQKRRV 79
            |||||||||||:
  Rat    69 NVLYISTQKRRM 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9344NP_611528.1 LSm6 8..73 CDD:212473 57/64 (89%)
LOC100360750XP_017454452.1 LSm6 7..74 CDD:212473 57/66 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334655
Domainoid 1 1.000 122 1.000 Domainoid score I5521
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 137 1.000 Inparanoid score I4450
OMA 1 1.010 - - QHG54779
OrthoDB 1 1.010 - - D1627235at2759
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 1 1.000 - - oto97402
orthoMCL 1 0.900 - - OOG6_102118
Panther 1 1.100 - - LDO PTHR11021
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3643
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.