DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15649 and CG15650

DIOPT Version :10

Sequence 1:NP_611527.2 Gene:CG15649 / 37371 FlyBaseID:FBgn0034563 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_611529.1 Gene:CG15650 / 37373 FlyBaseID:FBgn0034565 Length:145 Species:Drosophila melanogaster


Alignment Length:69 Identity:17/69 - (24%)
Similarity:27/69 - (39%) Gaps:6/69 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLLQFSPPADGFIIRLITETLQNNVAGEPVLHERTSWDFDPEAAKRARSLYYEKNGFRSSKFIER 82
            ||:.|...      :.:.:.|.....|.....:.:...|||...:..|.:|..|.|:|..:.|..
  Fly    60 LLVHFQKK------KAVLDYLDRLFFGNSPFQQPSEIPFDPHFGRSWRPVYERKFGYRGERLIAA 118

  Fly    83 LGVG 86
            ||.|
  Fly   119 LGSG 122

Return to query results.
Submit another query.