DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment KCNA2 and Task6

DIOPT Version :9

Sequence 1:	NP_004965.1	Gene:	KCNA2 / 3737	HGNCID:	6220	Length:	499	Species:	Homo sapiens
Sequence 2:	NP_001262541.1	Gene:	Task6 / 41671	FlyBaseID:	FBgn0038165	Length:	408	Species:	Drosophila melanogaster

Alignment Length:	120	Identity:	24/120 - (20%)
Similarity:	48/120 - (40%)	Gaps:	46/120 - (38%)

- Green bases have known domain annotations that are detailed below.

Human   322 KASMRELGLLI---FFLFIGVILFSSAVYFAEADERESQFPSIPD-------------------- 363
            |.::|.:.|::   .:|.:|..:|.:    .|::..:.::.::.|
  Fly     3 KQNVRTISLIVCTFTYLLVGAAVFDA----LESETEKRRWEALQDAEDMIIRKYNISQEDFKVME 63

Human   364 -------------------AFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGV 399
                               ||::|...:||:|||...|:|:|||:.....||.|:
  Fly    64 TVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
KCNA2	NP_004965.1	Tetramerization domain. /evidence=ECO:0000250\|UniProtKB:P63142	1..125
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..26
		BTB_POZ	33..159	CDD:365784
		Ion_trans	162..420	CDD:395416	24/120 (20%)
		S4-S5 linker. /evidence=ECO:0000250\|UniProtKB:P63142	312..325		1/2 (50%)
		Selectivity filter. /evidence=ECO:0000250\|UniProtKB:P63142	374..379		3/4 (75%)
		PDZ-binding. /evidence=ECO:0000250\|UniProtKB:P63142	497..499
Task6	NP_001262541.1	Ion_trans_2	<77..132	CDD:285168	16/42 (38%)
Task6	NP_001262541.1	Ion_trans_2	169..247	CDD:285168
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X19
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.000