Sequence 1: | NP_004965.1 | Gene: | KCNA2 / 3737 | HGNCID: | 6220 | Length: | 499 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649891.1 | Gene: | Task7 / 41125 | FlyBaseID: | FBgn0037690 | Length: | 340 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 47/206 - (22%) |
---|---|---|---|
Similarity: | 80/206 - (38%) | Gaps: | 49/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Human 304 IFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWA 368
Human 369 VVSMTTVGYGDMVP-------TTIGGKIVGSLCAIA-GVLTIALPVPVIVSNFNYFYHRETEGEE 425
Human 426 Q-AQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTAN-------- 481
Human 482 CT-LANTNYVN 491 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
KCNA2 | NP_004965.1 | Tetramerization domain. /evidence=ECO:0000250|UniProtKB:P63142 | 1..125 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..26 | ||||
BTB_POZ | 33..159 | CDD:365784 | |||
Ion_trans | 162..420 | CDD:395416 | 30/123 (24%) | ||
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 | 312..325 | 2/12 (17%) | |||
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 | 374..379 | 2/4 (50%) | |||
PDZ-binding. /evidence=ECO:0000250|UniProtKB:P63142 | 497..499 | ||||
Task7 | NP_649891.1 | Ion_trans_2 | <78..133 | CDD:285168 | |
Ion_trans_2 | 166..248 | CDD:285168 | 24/91 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X19 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |