DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNA2 and RpL37b

DIOPT Version :9

Sequence 1:NP_004965.1 Gene:KCNA2 / 3737 HGNCID:6220 Length:499 Species:Homo sapiens
Sequence 2:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster


Alignment Length:39 Identity:11/39 - (28%)
Similarity:15/39 - (38%) Gaps:12/39 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    65 RMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVN 103
            ||||...||..:   ||.         .:.||..::..|
  Fly    63 RMRYLKNLRRRF---RNG---------LREGGAAKKKTN 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNA2NP_004965.1 Tetramerization domain. /evidence=ECO:0000250|UniProtKB:P63142 1..125 11/39 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
BTB_POZ 33..159 CDD:365784 11/39 (28%)
Ion_trans 162..420 CDD:395416
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 312..325
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 374..379
PDZ-binding. /evidence=ECO:0000250|UniProtKB:P63142 497..499
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.