powered by:
Protein Alignment KCNA2 and RpL37b
DIOPT Version :9
Sequence 1: | NP_004965.1 |
Gene: | KCNA2 / 3737 |
HGNCID: | 6220 |
Length: | 499 |
Species: | Homo sapiens |
Sequence 2: | NP_611757.1 |
Gene: | RpL37b / 37669 |
FlyBaseID: | FBgn0034822 |
Length: | 89 |
Species: | Drosophila melanogaster |
Alignment Length: | 39 |
Identity: | 11/39 - (28%) |
Similarity: | 15/39 - (38%) |
Gaps: | 12/39 - (30%) |
- Green bases have known domain annotations that are detailed below.
Human 65 RMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVN 103
||||...||..: ||. .:.||..::..|
Fly 63 RMRYLKNLRRRF---RNG---------LREGGAAKKKTN 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2126 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.