DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act57B and Ankrd36

DIOPT Version :9

Sequence 1:NP_523800.1 Gene:Act57B / 37368 FlyBaseID:FBgn0000044 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_076305.2 Gene:Ankrd36 / 76389 MGIID:1923639 Length:1415 Species:Mus musculus


Alignment Length:252 Identity:58/252 - (23%)
Similarity:85/252 - (33%) Gaps:69/252 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWD-DMEKIWHHTFYNELRVAPEEHPVLLTE- 108
            |.||:|......::||::   |:| |..    |:|. |:..:...:..|.|..|.|...|  || 
Mouse   724 VRMGEKQEGHEFKSQSQK---TMK-PKR----TDWQLDIRHMLKSSDANRLSNAKERSHV--TEV 778

  Fly   109 ------APLNPKANREKMTQIMF-------ETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 160
                  |..:....:.|.||.:|       ..|.:||               ||.|...|:..|.
Mouse   779 KSWGDSALASDMYRKSKGTQDLFLKPLPCKGNFEAPA---------------RTLGTASDAPPGG 828

  Fly   161 SHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT-AEREIVRDIKEKLC------ 218
            ..|          .|....:|.|| |:|...:||.|...::... .|.|.|.:.....|      
Mouse   829 PTT----------RAFADEELRGR-LSDSEFRILEEEILAWEKVHLESESVSENLLNKCEGIISD 882

  Fly   219 -------YVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERF--RCPESLFQPS 266
                   |  ||.||.....:..||..:...|...:.....|...  .||::...|:
Mouse   883 ATDQQGRY--LDMEQATEVDSEGTSQLEQKNLDSSENTQPSNPDLSKTCPQAQSAPA 937

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act57BNP_523800.1 PTZ00281 1..376 CDD:173506 58/252 (23%)
Ankrd36NP_076305.2 Ank_2 37..130 CDD:289560
ANK repeat 37..64 CDD:293786
ANK 61..186 CDD:238125
ANK repeat 68..97 CDD:293786
ANK repeat 99..130 CDD:293786
ANK repeat 132..163 CDD:293786
Ank_2 137..229 CDD:289560
ANK 162..>240 CDD:238125
ANK repeat 165..196 CDD:293786
ANK repeat 198..229 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.