DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act57B and Actr8

DIOPT Version :9

Sequence 1:NP_523800.1 Gene:Act57B / 37368 FlyBaseID:FBgn0000044 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001296388.1 Gene:Actr8 / 361107 RGDID:1311878 Length:624 Species:Rattus norvegicus


Alignment Length:464 Identity:87/464 - (18%)
Similarity:165/464 - (35%) Gaps:159/464 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QKDSYVGDEA-------------QSKRGILTLKYPIEHGIITN-WDDMEKIWHHTFYNELRVAPE 100
            |.:..||:||             ..:||.|.: :|...|.:|. ..|:|.||.|.....|.:..:
  Rat   162 QPEYLVGEEALYVNPLDCYNIHWPIRRGQLNI-HPGPGGSLTAVLADIEVIWSHAIQKYLEIPLK 225

  Fly   101 E---HPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSH 162
            :   :..:|....:..|.:.:::..::........:.|..::|.:.:.||.::..|:|.||..:.
  Rat   226 DLKYYRCILLIPDIYNKQHVKELVHMILMKMGFAGIVVHQESVCATFGSGLSSTCVVDVGDQKTS 290

  Fly   163 TVPIYEGYALPHAILRLDLA--GRDLTDYLMKILTERGYSFTTTAERE----------IVRDIKE 215
            ...:.:|  :.|...||.||  |.|::.....::...|:.:     ||          :::.:||
  Rat   291 VCCVEDG--VSHRNTRLCLAYGGSDVSRCFYWLMQRAGFPY-----RECQLANKMDCLLLQHLKE 348

  Fly   216 KLCYVALDFE--------------------------------------------QEMAT------ 230
            ..|::..|..                                            |:|.|      
  Rat   349 TFCHLDQDISGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRSQ 413

  Fly   231 ---------------------AAASTSLEK---------------SYELPD-------------G 246
                                 :|.:|:..|               |.:||:             |
  Rat   414 GDPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLASSQG 478

  Fly   247 QVITIGNE---------RFRCPESLFQPSFLGMESCGIHETVYNSIMKCDV-DIRKDLYANIVMS 301
            ..:..|||         ..:...|||:...||::...:|     |:..|.. |.:|.:|::|::.
  Rat   479 DCLMAGNESEEALTALMSRKTAISLFEGKALGLDKAILH-----SVDCCSSDDTKKKMYSSILVV 538

  Fly   302 GGTTMYPGIADRMQKEITSLAPSTIK-----IKIIAPP---ERKYSVWIGGSILASLSTFQQMWI 358
            ||..|:....:.:|..|.:..|.:.:     :.:|..|   :.:...|.||::||.|.|.|::||
  Rat   539 GGGLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLISWKGGAVLACLDTTQELWI 603

  Fly   359 SKEEYDESG 367
            .:.|:...|
  Rat   604 YQREWQRFG 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act57BNP_523800.1 PTZ00281 1..376 CDD:173506 87/464 (19%)
Actr8NP_001296388.1 NBD_sugar-kinase_HSP70_actin 162..619 CDD:418402 87/464 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.