DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act57B and Arp10

DIOPT Version :9

Sequence 1:NP_523800.1 Gene:Act57B / 37368 FlyBaseID:FBgn0000044 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster


Alignment Length:390 Identity:86/390 - (22%)
Similarity:161/390 - (41%) Gaps:66/390 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK 69
            |...:|:|.|:...|.|||.:..||.:.|:.|       ||...|.:          ||      
  Fly    10 EKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEV-------VMTTTGIR----------KR------ 51

  Fly    70 YPIEHGIITNWDDMEKIWHH-------TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127
                   :.::|..|:::..       .|:..|.|:|:|...:|.|........||.:.:::|..
  Fly    52 -------LFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVH 109

  Fly   128 FN-SPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLM 191
            |: |..::|.:. :::|......|.:|:|.|...:..:|::.|..:..|.......|..:...:.
  Fly   110 FDVSSVLFVPVH-LIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIK 173

  Fly   192 KILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNE-- 254
            :.|.|.|...:...| .::.|||.:.|:|.   ..|.|.|.|:....:....||...|...|:  
  Fly   174 RQLVESGVKESLLTE-SVLEDIKVRTCFVT---TMERAKARANGDENQPTPAPDVDYIVSDNDAV 234

  Fly   255 -------RFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIAD 312
                   |....|.:|:.|   .|...:...:..||:.|.:|:|:.|..::.:.||.:|..|:..
  Fly   235 IQVPGLLRESAYEIMFEAS---NERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLA 296

  Fly   313 RMQKEITSLAP----------STIKIKII-APPERKYSVWIGGSILASLSTFQQMWISKEEYDES 366
            |:::|:..|..          ..::.|.. |..::.::.|:||::..:....|...:.||.|.:|
  Fly   297 RLRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKS 361

  Fly   367  366
              Fly   362  361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act57BNP_523800.1 PTZ00281 1..376 CDD:173506 86/390 (22%)
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 79/366 (22%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 85/388 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467825
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.