DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act57B and Arp6

DIOPT Version :9

Sequence 1:NP_523800.1 Gene:Act57B / 37368 FlyBaseID:FBgn0000044 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster


Alignment Length:408 Identity:110/408 - (26%)
Similarity:198/408 - (48%) Gaps:54/408 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKY- 70
            |.:|:|||:...|.|.|..|.|..| |:.:.:.:.:       ::.::||::....|....|.| 
  Fly     4 AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTSALYYI 60

  Fly    71 -PIEHGIITNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAM 133
             ..:.|.:.||...:.:|.:.|..: :..:.|...:::||..:|.::.:|...:|:||.:....:
  Fly    61 LAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGV 125

  Fly   134 YVAIQAVLSLY-----ASGRTT-----GIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 188
            |....|.|:.:     :..|||     .|::|.|...:|.||...|..:...|.|:|:.|:.||:
  Fly   126 YKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTN 190

  Fly   189 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEK------SYELPD-- 245
            .|.::::.|  ......|..:|..|||.:|:||.||:|.|   ....|.||      .|.|||  
  Fly   191 QLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAM---QVHYSEEKRREVTVDYVLPDFT 250

  Fly   246 -------------------GQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIR 291
                               .|::::.||||..||.||.||.:|::..||.|.|.:.:..|..:..
  Fly   251 TVKRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAH 315

  Fly   292 KDLYANIVMSGGTTMYPGIADRMQKEITSLAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356
            ::|..||::.||:..:||...|:::::.:|.|..:::.:|.|.:.....|.||..:|:...|::.
  Fly   316 RELLLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEF 380

  Fly   357 WISKEEYDESG-PGIVHR 373
            ..::::|:|.| .||..|
  Fly   381 VYTQDDYEEYGFQGINQR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act57BNP_523800.1 PTZ00281 1..376 CDD:173506 110/408 (27%)
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 109/406 (27%)
COG5277 6..391 CDD:227602 105/397 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.