DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act57B and Actl9

DIOPT Version :9

Sequence 1:NP_523800.1 Gene:Act57B / 37368 FlyBaseID:FBgn0000044 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001101547.1 Gene:Actl9 / 314659 RGDID:1306886 Length:415 Species:Rattus norvegicus


Alignment Length:375 Identity:155/375 - (41%)
Similarity:243/375 - (64%) Gaps:9/375 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 68
            :..|:|:|.|:|.||.||||...|.....:|:| :|:.|... |..:.::::|:.|:| |..|.|
  Rat    47 KTGAVVIDMGTGTCKVGFAGQSQPTYSVATILGCQPKKQATK-GQSELETFIGEAARS-RPELRL 109

  Fly    69 KYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAM 133
            ..||.:||:.:|:..|.||.|...::||||.:|||:|.::.|.:|..||||:.::.||:.:|||:
  Rat   110 VKPIRNGIVVDWEAAELIWRHILEHDLRVATQEHPLLFSDPPFSPATNREKLVEVAFESLHSPAL 174

  Fly   134 YVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198
            |||.|:|||:||.||..|:|:|:|.|||:|||:.:||.|||||.||||||..||.:|.:::...|
  Rat   175 YVASQSVLSVYAHGRVNGLVVDTGHGVSYTVPVVQGYNLPHAIQRLDLAGNHLTAFLAEMILGSG 239

  Fly   199 YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPESLF 263
            :|. ...:.::|.:||...||:|.||::|.  |......:::..||||:.:|:|.|.|:|||.||
  Rat   240 FSL-QQEDLDLVENIKHHYCYLASDFQKEQ--ARPDQECKQTLRLPDGRTVTLGKELFQCPELLF 301

  Fly   264 QPSFL-GMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKE-ITSLAPSTI 326
            .|..: |:...|:......|:::...|:|..:..|:::.||::::.|:..|.:.| :.||:|.. 
  Rat   302 HPPEIPGLSPMGLPAMAEQSLLRVPQDLRPHVAQNVILCGGSSLFTGLESRFRAELLRSLSPED- 365

  Fly   327 KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 376
            .:.::|.|.|..||||||||||||..||..|:.:|:|:|.||.:|:|||:
  Rat   366 HVVVMAQPNRNLSVWIGGSILASLHAFQSCWVLREQYEEMGPQVVYRKCY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act57BNP_523800.1 PTZ00281 1..376 CDD:173506 154/373 (41%)
Actl9NP_001101547.1 NBD_sugar-kinase_HSP70_actin 46..415 CDD:302596 154/373 (41%)
Actin 48..414 CDD:278451 153/371 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.