DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act57B and SPBC56F2.03

DIOPT Version :9

Sequence 1:NP_523800.1 Gene:Act57B / 37368 FlyBaseID:FBgn0000044 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_596714.1 Gene:SPBC56F2.03 / 2540863 PomBaseID:SPBC56F2.03 Length:380 Species:Schizosaccharomyces pombe


Alignment Length:374 Identity:80/374 - (21%)
Similarity:128/374 - (34%) Gaps:116/374 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EHGI-ITNWDDMEKIWHHTFYNELRVAPEEH---PVLLTEAPLNPKANREKMTQIMFETFNSPAM 133
            |.|| |.|..|.|..|      ::.:.|.:.   |:.:....:.         :....|||..|.
pombe    16 EFGIYIGNASDKEPTW------KVDLVPYKQSWVPISIVTTIIQ---------RYCLNTFNCLAE 65

  Fly   134 YVAIQAVLSLYASGRTTGIVLDSGDGVSHT--VPIYEGYALP-HAILRLDLAGRDLTDYLMK--- 192
            .|.:..||.::.:.:..   .:..||:.:|  |||......| .|||........:.|..||   
pombe    66 IVRVVLVLDIFVTRKQK---KELCDGLFNTLNVPITLWICAPLTAILSTSTRDAIIVDIGMKETK 127

  Fly   193 --------ILTERGYSFTTTAEREIVRDIKEKL--CY---------VALDFEQEMATAAASTSLE 238
                    ||..    :|.|::|.: ..:.|::  |:         ..|:.|:...|.|...||.
pombe   128 FIVILDLCILMH----YTKTSKRSL-STVLERMADCFKLNNKKNSQKLLEDEEFAVTEALMKSLL 187

  Fly   239 KS----------YELPD-------GQVITIGN-----------------ERFRCP--------ES 261
            ||          |:|.|       ..::.:..                 |:.|.|        |:
pombe   188 KSRVPSKPTEELYQLTDQEAYFRYSDILPLAETTCQTNKTERGSSFNDAEKIRVPSWIANAGIEA 252

  Fly   262 LFQPSFLGMESCGIHETVYNSIMK----CDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITSLA 322
            ||:.|..|..... .:.:.|.::.    ..:|||:.:...||.:|.....||...|.|.|:||..
pombe   253 LFEGSDAGGSDIA-DQALPNVLLSLYRILPIDIRRIMSKLIVFNGILPSLPGWYQRFQNEMTSRG 316

  Fly   323 PSTIKIKIIAPPERKYS---VWIGGSILASLSTFQQMWISKEEYDESGP 368
                 :.|.|.|.:..:   .|.|.|....         |:.:||...|
pombe   317 -----LAIKAVPGQTTADMMAWNGASTTCE---------SQLDYDPDDP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act57BNP_523800.1 PTZ00281 1..376 CDD:173506 80/374 (21%)
SPBC56F2.03NP_596714.1 NBD_sugar-kinase_HSP70_actin <69..338 CDD:302596 60/282 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.