DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act57B and LOC102723502

DIOPT Version :9

Sequence 1:NP_523800.1 Gene:Act57B / 37368 FlyBaseID:FBgn0000044 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001382398.1 Gene:LOC102723502 / 102723502 -ID:- Length:581 Species:Homo sapiens


Alignment Length:281 Identity:56/281 - (19%)
Similarity:95/281 - (33%) Gaps:86/281 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GSGMCKAGFAG--DDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL-TLK------ 69
            |||....|.:|  ||:......|.:|:..|.......|...|.||.........: ||:      
Human    37 GSGKSNMGTSGDHDDSFMKTLRSKMGKCCHHCFPCCRGSGTSNVGTSGDHDNSFMKTLRSKMGKW 101

  Fly    70 ----YPIEHGI----ITNW-----------------DDMEKIWHHTFYNELRVAPEEHPVLLTEA 109
                :|...|.    :..|                 :|::|:....::.  :|..::..|:|.:.
Human   102 CCHCFPCCRGSGKSNVGTWGDYDDSAFMEPRYHVRREDLDKLHRAAWWG--KVPRKDLIVMLRDT 164

  Fly   110 PLNPKANREKMTQIMFETFNS-----------------------PAMYVAIQ-----AVLSLYAS 146
            .:| |.:::|.|.:...:.|.                       .|:..|:|     .||.|...
Human   165 DMN-KRDKQKRTALHLASANGNSEVVQLLLDRRCQLNVLDNKKRTALIKAVQCQEDECVLMLLEH 228

  Fly   147 GRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD--------LTDYLMKILTERGYSFTT 203
            |....|..:.|:...|.....|...:..|:|   |.|.|        ||..|:.:..::      
Human   229 GADGNIQDEYGNTALHYAIYNEDKLMAKALL---LYGADIESKNKCGLTPLLLGVHEQK------ 284

  Fly   204 TAEREIVRD-IKEKLCYVALD 223
               :|:|:. ||:|....|||
Human   285 ---QEVVKFLIKKKANLNALD 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act57BNP_523800.1 PTZ00281 1..376 CDD:173506 56/281 (20%)
LOC102723502NP_001382398.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100127
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.