DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and ISX

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_001290437.1 Gene:ISX / 91464 HGNCID:28084 Length:245 Species:Homo sapiens


Alignment Length:214 Identity:75/214 - (35%)
Similarity:93/214 - (43%) Gaps:65/214 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   538 GEKITSGS------DDEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKV 596
            ||...|||      .|:.|:   .:|..||.||||||.||||||:.|..:|||||:.|.:||.::
Human    58 GEAAASGSGLEKPPKDQPQE---GRKSKRRVRTTFTTEQLHELEKIFHFTHYPDVHIRSQLAARI 119

  Fly   597 NLPEVRVQVWFQNRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVD------PWLSPPLL 655
            ||||.|||:||||:|||||:|||..:|        ..|.:|...:..||.:      .|.|..| 
Human   120 NLPEARVQIWFQNQRAKWRKQEKIGNL--------GAPQQLSEASVALPTNLDVAGPTWTSTAL- 175

  Fly   656 SALPGFLSHPQTVYPSYLTPPLSLAPGNLTMSSLAAMGHHHAHNGPPPPHV----GHGGHGQPQP 716
                           ..|.||.|..|.  ....||:...        |..:    .|....||.|
Human   176 ---------------RRLAPPTSCCPS--AQDQLASAWF--------PAWITLLPAHPWETQPVP 215

  Fly   717 PPP------------PPPH 723
            ..|            ||||
Human   216 GLPIHQTCIPVLCILPPPH 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 35/51 (69%)
OAR 876..892 CDD:281777
ISXNP_001290437.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..86 10/30 (33%)
Homeobox 86..138 CDD:278475 35/51 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.