DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and PHOX2B

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_003915.2 Gene:PHOX2B / 8929 HGNCID:9143 Length:314 Species:Homo sapiens


Alignment Length:323 Identity:94/323 - (29%)
Similarity:129/323 - (39%) Gaps:67/323 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 QQQGFQHDFRNSGNGNPNGNSNSGDHGERLNADSDSLVNGSCASSEDLNQTNSSEQGEKITSGSD 546
            |..|||:        ||...:.....|      ..||..|||:.....:..:|..........:|
Human    38 QASGFQY--------NPIRTTFGATSG------CPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTD 88

  Fly   547 DEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRR 611
            ..|.::   |:|.||.|||||:.||.||||.|.::||||:|:|||||:|::|.|.||||||||||
Human    89 HGGLNE---KRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRR 150

  Fly   612 AKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALPGFLSHPQTVYPSYLTPP 676
            ||:|:||::.:.......         .|:||...|.              |.......:..|.|
Human   151 AKFRKQERAAAAAAAAAK---------NGSSGKKSDS--------------SRDDESKEAKSTDP 192

  Fly   677 LSL-APGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPP--------PPPPHGVPHPHGSH 732
            .|. .||               .|..|.|..|..|.|...|.|        |..|.|.|...|:.
Human   193 DSTGGPG---------------PNPNPTPSCGANGGGGGGPSPAGAPGAAGPGGPGGEPGKGGAA 242

  Fly   733 HVVPLSHLSPHLSRMSPHA--TSLGSPHHGVTPLGTPLHSSLPPSSTATTVAVSSSQSSSSSA 793
            .....:..:...:..:...  .:.|.|..|..|...|: :|:|.|......:|.||....:.|
Human   243 AAAAAAAAAAAAAAAAAAGGLAAAGGPGQGWAPGPGPI-TSIPDSLGGPFASVLSSLQRPNGA 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 37/51 (73%)
OAR 876..892 CDD:281777
PHOX2BNP_003915.2 Homeobox 102..155 CDD:395001 37/52 (71%)
polyalanine repeat 241..260 0/18 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.