DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rx and HB-7

DIOPT Version :9

Sequence 1:	NP_726006.3	Gene:	Rx / 37367	FlyBaseID:	FBgn0020617	Length:	904	Species:	Drosophila melanogaster
Sequence 2:	NP_182191.1	Gene:	HB-7 / 819280	AraportID:	AT2G46680	Length:	258	Species:	Arabidopsis thaliana

Alignment Length:	64	Identity:	20/64 - (31%)
Similarity:	36/64 - (56%)	Gaps:	1/64 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   556 KKKH-RRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQE 618
            |..| :.|:..|:..|:..||..||.....:...:.:||.::.|...:|.:||||:||:|:.::
plant    25 KSNHNKNNQRRFSDEQIKSLEMMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRARWKSKQ 88

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rx	NP_726006.3	Homeobox	563..615	CDD:278475	16/51 (31%)
Rx	NP_726006.3	OAR	876..892	CDD:281777
HB-7	NP_182191.1	Homeobox	35..85	CDD:395001	16/49 (33%)
HB-7	NP_182191.1	HALZ	87..126	CDD:396657	0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910