DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and ALX1

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_008913.2 Gene:ALX1 / 8092 HGNCID:1494 Length:326 Species:Homo sapiens


Alignment Length:408 Identity:101/408 - (24%)
Similarity:145/408 - (35%) Gaps:163/408 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   509 ERLNADSDSLVNGSCASSE------DLNQT--NSSEQGEKITSGSDDEGQ--------DDNCAKK 557
            ||.:...||.||......|      :||:.  |.:........|..::|:        |.|.:..
Human    66 ERTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELGDKCDSNVSSS 130

  Fly   558 KHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSES 622
            |.||:|||||:.||.|||:.|:|:||||||.||:||::..|.|.||||||||||||||::|:...
Human   131 KKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQ 195

  Fly   623 LRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALPGFLSHPQTVYPSYLTPPLSLAPGNLTMS 687
            ::...:||.....                   :|.||...|:||.        ..:|..||.:..
Human   196 IQQAKSHFAATYD-------------------ISVLPRTDSYPQI--------QNNLWAGNASGG 233

  Fly   688 SLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPPPPPHGVPHPHGSHHVVPLSHLSPHLSRMSPHAT 752
            |:..                                                     |.|.|..|
Human   234 SVVT-----------------------------------------------------SCMLPRDT 245

  Fly   753 SLGSPHHGVTPLGTPLHSSLPPSSTATTVAVSSSQSSSSSASLECSGPDVCMSPQNLSIGNADSN 817
            |     ..:||..   ||   |.:.::....|:.|:..|...|                      
Human   246 S-----SCMTPYS---HS---PRTDSSYTGFSNHQNQFSHVPL---------------------- 277

  Fly   818 GDGRDLSSDLDAGSTSSNPGSSLDKCAASANIELLDVGRDSPPPPPTPTGKGSSTPPTDMRSNSI 882
              ....:..|..|:|:   |.:.:                             :.|..:.||:||
Human   278 --NNFFTDSLLTGATN---GHAFE-----------------------------TKPEFERRSSSI 308

  Fly   883 ATLRIKAKEHLDNLNKGM 900
            |.||:|||||..|::..|
Human   309 AVLRMKAKEHTANISWAM 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 36/51 (71%)
OAR 876..892 CDD:281777 10/15 (67%)
ALX1NP_008913.2 Homeobox 135..189 CDD:365835 37/53 (70%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 192..326 44/280 (16%)
OAR 302..320 CDD:367680 12/17 (71%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319 9/12 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.