DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and Rhox13

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_001171931.1 Gene:Rhox13 / 73614 MGIID:1920864 Length:232 Species:Mus musculus


Alignment Length:163 Identity:48/163 - (29%)
Similarity:71/163 - (43%) Gaps:54/163 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 DSDSLVNGSCAS---SEDLNQTNSSEQGEKITSGSDDEGQDDNCAK------------------- 556
            ||...:  .||:   ||..:::.|..:.|..:|.|.||..||:...                   
Mouse    53 DSGGAI--GCATVKESESDSESESDSESESDSSDSSDESDDDSSTSDEDTSDPEEAAAPSVAAVA 115

  Fly   557 -------------------------KKHRRNRTT-----FTTYQLHELERAFEKSHYPDVYSREE 591
                                     ::|.|.|..     |..:|:.|:|..||::.|||:.:|.|
Mouse   116 AAAAPPTVPAAAAIQIPGPYRYRPPRRHVRRRRRGPPFHFAQWQVEEMESLFEETQYPDLLTRGE 180

  Fly   592 LAMKVNLPEVRVQVWFQNRRAKWRRQEKSESLR 624
            ||..:|:|||:|:|||.|||||.|:.|:.|.||
Mouse   181 LARTLNVPEVKVKVWFTNRRAKQRKIERREMLR 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 27/56 (48%)
OAR 876..892 CDD:281777
Rhox13NP_001171931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..114 14/62 (23%)
Homeobox 155..204 CDD:278475 26/48 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.