DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and Rhox13

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:XP_001077350.3 Gene:Rhox13 / 691244 RGDID:1586264 Length:234 Species:Rattus norvegicus


Alignment Length:168 Identity:51/168 - (30%)
Similarity:80/168 - (47%) Gaps:40/168 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 GFQHDFRNSGNGNPNGNSNSGDHGERLNADSDSLVNGSCASSEDLNQTNSSEQGEKITSGSDDEG 549
            |:...:..:..|:|...|.| |..|..:.:.|....|      |.:..::|:|     ..||.|.
  Rat    60 GYDTVYEPNVKGDPKQESES-DTEESYDDEDDDEDEG------DEDDLSTSDQ-----DTSDPEQ 112

  Fly   550 QD------------------------DNCAKKKHRRNRTT----FTTYQLHELERAFEKSHYPDV 586
            ::                        ....:::|||:|.:    ||.:|:.|:|..||::.||||
  Rat   113 EEAALFVAAAAPPIAPAAAAIQIPGPHRSRRRRHRRHRRSSPYLFTQWQVEEMENLFEETPYPDV 177

  Fly   587 YSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSESLR 624
            .:|.|||..:|:|||:|:|||.|||||.|:.|:...||
  Rat   178 LTRGELARTLNVPEVKVKVWFSNRRAKQRKNERRAMLR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 29/55 (53%)
OAR 876..892 CDD:281777
Rhox13XP_001077350.3 Homeobox 157..206 CDD:278475 28/48 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.