DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and Isx

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:XP_008770554.1 Gene:Isx / 682968 RGDID:1592776 Length:242 Species:Rattus norvegicus


Alignment Length:226 Identity:80/226 - (35%)
Similarity:104/226 - (46%) Gaps:71/226 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   509 ERLNADSDSLVNGSCASSEDLNQTNSSEQGEKITSGSDDEGQDDNCAKKKHRRNRTTFTTYQLHE 573
            ||.|......:.|.     |..||.:|  |.|:...:.|:.|::   :|..||.||||||.||.|
  Rat    38 ERRNLPRPQSIGGG-----DSRQTTTS--GSKLEKPTQDQPQEE---RKNKRRVRTTFTTEQLQE 92

  Fly   574 LERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSESL--------------- 623
            ||:.|..:||||::.|.:||.::||||.|||:||||:|||||:||||.||               
  Rat    93 LEKLFHFTHYPDIHVRSQLASRINLPEARVQIWFQNQRAKWRKQEKSGSLSAPQQPGSCTDAHCS 157

  Fly   624 -RLGLTH-----------FTQLPHRLGCGASGLPVDPWLSPPLLSALPGFLSHPQTVYPSYLTPP 676
             .:|.||           |..:|    |..|..|:.| :.|    |.|.:.|||..:.| ||.||
  Rat   158 AHIGATHRMLPPLSDSARFKLVP----CPDSPCPMAP-MGP----AAPAWPSHPAALCP-YLHPP 212

  Fly   677 LSLAPGNLTMSSLAAMGHHHAHNGPPPPHVG 707
                                    .|.|.||
  Rat   213 ------------------------TPKPQVG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 33/51 (65%)
OAR 876..892 CDD:281777
IsxXP_008770554.1 Homeobox 82..134 CDD:278475 33/51 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.