DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and DRGX

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:XP_011538391.1 Gene:DRGX / 644168 HGNCID:21536 Length:298 Species:Homo sapiens


Alignment Length:402 Identity:105/402 - (26%)
Similarity:136/402 - (33%) Gaps:184/402 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 TSGSDDEGQ-DDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ- 604
            |.|:...|. ||...::|.||||||||..||..||..|.::|||||::|||||||:||.|.||| 
Human    15 TFGNHSSGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQL 79

  Fly   605 ----------------------------------VWFQNRRAKWRRQEKSESLRLGLTHFTQLPH 635
                                              |||||||||||:.|:                
Human    80 ANSCLKTELQIEINDTIIEHSEVEDHNFSLKGARVWFQNRRAKWRKTER---------------- 128

  Fly   636 RLGCGASGLPVDPWLSPPLLSALPGFLSHPQTVYPSYLTPPLSLAPGNLTMSSLAAMGHHHAHNG 700
                |||  ..:|....|:....|               ||:.    |:              |.
Human   129 ----GAS--DQEPGAKEPMAEVTP---------------PPVR----NI--------------NS 154

  Fly   701 PPPPHVGHGGHGQPQPPPPPPPHGVPHPHGSHHVVPLSHLSPHLSRMSPHA----TSLGSPHHGV 761
            |||                          |..            :|....|    .|||   ..|
Human   155 PPP--------------------------GDQ------------ARSKKEALEAQQSLG---RTV 178

  Fly   762 TPLGTPLHSSLPPS--STATTVAVSSSQSSSSSASLE------CSGPDV----------CMSPQN 808
            .|.|....|.||.:  :|||     .:|:.|..|||:      |..||.          |.|.:.
Human   179 GPAGPFFPSCLPGTLLNTAT-----YAQALSHVASLKGGPLCSCCVPDPMGLSFLPTYGCQSNRT 238

  Fly   809 LSIG----NADSNGDGRDLSSDLDAGSTSSNPGSSLDKCAASANIELLDVGRDSPPPPPTPTGKG 869
            .|:.    .|..:.:....|::| ..||||:||               .|.:.:|     |.|..
Human   239 ASVATLRMKAREHSEAVLQSANL-LPSTSSSPG---------------PVAKPAP-----PDGSQ 282

  Fly   870 SSTPPTDMRSNS 881
            ..|.||..:|.:
Human   283 EKTSPTKEQSEA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 37/86 (43%)
OAR 876..892 CDD:281777 1/6 (17%)
DRGXXP_011538391.1 Homeobox 37..124 CDD:278475 37/86 (43%)
OAR 236..252 CDD:281777 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.