DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and Drgx

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:429 Identity:124/429 - (28%)
Similarity:159/429 - (37%) Gaps:115/429 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   551 DDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWR 615
            |:...::|.||||||||..||.|||.||.::|||||::||:||||:||.|.||||||||||||||
  Fly    44 DETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWR 108

  Fly   616 RQEKSESLRLGLTHFTQLPHRLGCGASGLPV--DPWLSPPLLSALPGFLSHPQTVYPSYLTPPLS 678
            :.|:.:.        .|.....|..:|.|..  |...|.|   .:.|.:.......|........
  Fly   109 KAERLKD--------EQRKRENGESSSSLDKLHDSRESSP---DITGEIDDDMDDLPPRQRSHSP 162

  Fly   679 LAPGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPPP--------PPH-----------G 724
            ||.|.  |....:..|.|:|:..|    |.|.|........|        .||           |
  Fly   163 LANGQ--MEQQHSHSHSHSHSRSP----GGGMHLDSSDNERPLSSNQLTATPHSASQSLGSISAG 221

  Fly   725 VPHPHGSHHV---VPL------SHLSPHLSRMSPHATSLGSP---------------HHGVTPLG 765
            .|.|.|.|..   .||      ...||..||.:.....:|.|               ....||..
  Fly   222 SPSPSGMHREREHTPLVGGGGQGPSSPSNSRNTDSPIEVGGPMSLTTGSRMAASSNNSASSTPTP 286

  Fly   766 TPLHSSLPPSSTATTVAVSSSQ-----SSSSSASLECSGPDVCMSPQNLSIGNADSNGDGRDLS- 824
            |..|:...|.|:|...|...|.     ...|:||....|....:|.|:.....|.:....|..: 
  Fly   287 TTPHAPQMPHSSAAAAAAFGSHIFGNFGGGSNASDSNCGFRPVLSEQSAVAAAAAAAAAQRSANH 351

  Fly   825 ---------------SDLDAGSTSSNPGSSLDKCAASANIELLDVGRDSPPPP-----------P 863
                           ..|..|....:|..||..|.:.           .||||           |
  Fly   352 PPLFLPPHLAAQFTHQPLFPGLKGVSPFQSLCSCCSL-----------KPPPPPGSSVVAPLSIP 405

  Fly   864 TPTGKGSSTPPT----------DMRSNSIATLRIKAKEH 892
            ..:...:|:|.:          |.||||:|.||.||:||
  Fly   406 VSSSSAASSPESPKSSGQGSVHDPRSNSVAELRRKAQEH 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 38/51 (75%)
OAR 876..892 CDD:281777 10/15 (67%)
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 38/51 (75%)
OAR 428..445 CDD:281777 12/17 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143142at50557
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.