DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and phox2bb

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_001014818.1 Gene:phox2bb / 544654 ZFINID:ZDB-GENE-050407-3 Length:284 Species:Danio rerio


Alignment Length:320 Identity:89/320 - (27%)
Similarity:125/320 - (39%) Gaps:91/320 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 QQQGFQHDFRNSGNGNPNGNSNSGDHGERLNADSDSLVNGSCASSEDLNQTNSSEQGEKITSGSD 546
            |..|||:        ||...:.....|      ..||..|||:.....:..:|..........:|
Zfish    38 QASGFQY--------NPIRTTFGATSG------CPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTD 88

  Fly   547 DEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRR 611
            ..|.::   |:|.||.|||||:.||.||||.|.::||||:|:|||||:|::|.|.||||||||||
Zfish    89 HGGLNE---KRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRR 150

  Fly   612 AKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALPGFLSHPQTVYPSYLTPP 676
            ||:|:||::.:.......          ..:|...|               |..:....:..|.|
Zfish   151 AKFRKQERAAAAAAAAAK----------NGTGKKSD---------------SREEDSKEAKATDP 190

  Fly   677 LSLAPGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPPPPPH-GVPHPHGSHHVV----P 736
            .|.                                |.|.|.|.|..: |.|.|.|.....    |
Zfish   191 DST--------------------------------GGPGPNPNPTSNCGGPSPTGGQVSATGNGP 223

  Fly   737 LSHLSPHLSRMSPHATSLG---SPHHGVTPLGTPLHSSLPPSSTATTVAVSSSQSSSSSA 793
            :..:...::.|.|.|.:.|   :|       ||  .:|:|.|......:|.||....:.|
Zfish   224 VEQVKTSVAGMGPTAPTQGWASAP-------GT--ITSIPDSLGGPFASVLSSLQRQNGA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 37/51 (73%)
OAR 876..892 CDD:281777
phox2bbNP_001014818.1 Homeobox 102..154 CDD:278475 37/51 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.