DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and LOC4577217

DIOPT Version :10

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:XP_061502892.1 Gene:LOC4577217 / 4577217 VectorBaseID:AGAMI1_010281 Length:357 Species:Anopheles gambiae


Alignment Length:159 Identity:65/159 - (40%)
Similarity:88/159 - (55%) Gaps:12/159 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 GNGNPNGNSNSGDHGERLNADSDSLVNGSCASSEDLNQTNSSEQGEKITSGSDDEGQ----DDNC 554
            |.|...|.:.:|......|..|..|:||  |:..::: .:.:.||......:||.|.    ||..
Mosquito    82 GGGGGGGGAGTGLGSAGANGLSGGLLNG--ATHPNIS-PHRAMQGPPSEDSNDDRGSAADGDDES 143

  Fly   555 AKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEK 619
            :..|.||:||.|.::||.||||||..||||||:.||.|||:::|.|.||.|||||||||||::|.
Mosquito   144 SASKRRRSRTNFNSWQLEELERAFSASHYPDVFMREALAMRLDLKESRVAVWFQNRRAKWRKKEH 208

  Fly   620 SESLRLGLTHFTQLPHRLGCGASGLPVDP 648
            ::.   |........|...|  ||.|:.|
Mosquito   209 TKK---GPGRPAHNAHPQSC--SGEPIPP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeodomain 560..616 CDD:459649 38/55 (69%)
OAR 876..892 CDD:461067
LOC4577217XP_061502892.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.