DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and si:dkey-43p13.5

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:XP_002661267.2 Gene:si:dkey-43p13.5 / 407678 ZFINID:ZDB-GENE-131121-510 Length:315 Species:Danio rerio


Alignment Length:171 Identity:53/171 - (30%)
Similarity:70/171 - (40%) Gaps:50/171 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   558 KHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSES 622
            |.||.|..::::||.|||:.|:.:||||::.||.||::::|.|.||||||||||||.|||.|   
Zfish   140 KQRRARANYSSWQLEELEKTFQSTHYPDIFMREALALRLDLIEARVQVWFQNRRAKMRRQLK--- 201

  Fly   623 LRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALPGFLSHPQTVYPSYLTPPLSLAPGNLTMS 687
                      |..:.|...|....|              ..||::   |...|.|          
Zfish   202 ----------LQIQTGEQCSQRDTD--------------TRHPES---SISNPEL---------- 229

  Fly   688 SLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPPPPPHGVPHP 728
                      ||..|.|.............|.|.|..:..|
Zfish   230 ----------HNNSPSPCWDRNQDRTNPAHPKPSPSAIQSP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 29/51 (57%)
OAR 876..892 CDD:281777
si:dkey-43p13.5XP_002661267.2 Homeobox 145..197 CDD:278475 29/51 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.