DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and phox2a

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_996953.2 Gene:phox2a / 404602 ZFINID:ZDB-GENE-000223-14 Length:280 Species:Danio rerio


Alignment Length:220 Identity:79/220 - (35%)
Similarity:106/220 - (48%) Gaps:39/220 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 SDDEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQN 609
            ||..|.::   |:|.||.|||||:.||.||||.|.::||||:|:|||||:|::|.|.||||||||
Zfish    81 SDASGLNE---KRKQRRIRTTFTSSQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQN 142

  Fly   610 RRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALP---GFLSHPQTVYPS 671
            ||||:|:||::.:.:...:...:.|    ..|.....|........|..|   ..:|.|..  .|
Zfish   143 RRAKFRKQERAANSKASSSSGGKKP----SDARSSSEDDESKESTCSPTPDSTANMSSPGA--RS 201

  Fly   672 YLTPPLSLAPGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPPPPPHGVPHPHGSHHVVP 736
            .|:|  |.|||..:..|.|::.  .|....|.|.:|.|        .|.|.|             
Zfish   202 SLSP--SPAPGPASTFSPASIS--PALKSSPWPSLGSG--------TPGPTH------------- 241

  Fly   737 LSHLSPHLSRMSPHATSLGSPHHGV 761
             :|....|....| |.|:..|..||
Zfish   242 -THTQELLKAWQP-ADSMSGPFAGV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 37/51 (73%)
OAR 876..892 CDD:281777
phox2aNP_996953.2 Homeobox 96..148 CDD:306543 37/51 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.