DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and CG9876

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:295 Identity:87/295 - (29%)
Similarity:117/295 - (39%) Gaps:105/295 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 LPGGN-----YGIRPRSMEEVHHQQQSHHHQQQ---QQQQQQQQQLQQQQGF--------QHDFR 491
            ||.||     ||  |....|::...|||:.:.:   :.:::..:.|.:...|        :||..
  Fly    11 LPVGNPGNFYYG--PTVSGEIYSSHQSHNLESEDKLEDREESGRNLDKIHRFSVDNIMEMKHDAY 73

  Fly   492 NSGNGNPNGNSNSGDHGERL-NADSDSLVNGSCASSEDLNQTNSSEQGEKITSGSDDEGQDDNCA 555
            :.|......:||.|..|... .||..:..:|:                  :.:|....       
  Fly    74 SKGKMAMELSSNFGPTGAGCGGADRPAPCSGN------------------LPAGGGHH------- 113

  Fly   556 KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKS 620
            .:|.|||||||::.||..||:.||::||||.:.|||||.||:|.|.||||||||||||:||.|:|
  Fly   114 SRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERS 178

  Fly   621 ESLRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALPGFLSHPQTVYPSYLTPPLSLAPGNLT 685
            ...|                            .||...|            .|.|    ||.:..
  Fly   179 VGSR----------------------------TLLDTAP------------QLVP----APISNN 199

  Fly   686 MSSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPPP 720
            |...|.|.|.|                 |||||||
  Fly   200 MHKYANMPHPH-----------------PQPPPPP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 35/51 (69%)
OAR 876..892 CDD:281777
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 35/51 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.