DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and Rhox12

DIOPT Version :10

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_001020072.1 Gene:Rhox12 / 363437 RGDID:1563789 Length:175 Species:Rattus norvegicus


Alignment Length:182 Identity:48/182 - (26%)
Similarity:75/182 - (41%) Gaps:36/182 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 QSHHHQQQQQQQQQQQ---QLQQQQGFQHDFRNSGNGNPNGNSNSGDHGERLNADSDSLVNGSCA 524
            ||||.:....:.::.:   .|...:..:..  :.|.|:.||              ||.|......
  Rat     4 QSHHVEPSSYKLEENEIEVSLDADEAAEGG--SFGEGSLNG--------------SDKLKYEGIP 52

  Fly   525 SSEDL----------NQTNSSEQGEKITSGSDDEGQDDNCAK---KKHRRNRTT----FTTYQLH 572
            ..:|.          |......:|....||.....:..|.|.   .:.||.|..    .|..||.
  Rat    53 DKDDRIYVGDVKYIGNDVKDEYRGSHQGSGDSQLEEQKNLASPTIPQFRRTRPRIQLGLTPRQLS 117

  Fly   573 ELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSESLR 624
            |||..||.:.||||.:|..||..:.|.|.||:.||:.|||::|::::::.|:
  Rat   118 ELEDFFETTKYPDVITRRNLAKHLYLAESRVKRWFKRRRARYRKEQQTQMLK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeodomain 560..616 CDD:459649 27/59 (46%)
OAR 876..892 CDD:461067
Rhox12NP_001020072.1 homeodomain 101..163 CDD:238039 28/61 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.