DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and Gsc

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster


Alignment Length:509 Identity:119/509 - (23%)
Similarity:172/509 - (33%) Gaps:197/509 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 RNPETVSDGSVDP-----SLGDDDATDLRCGMTLT--QLRSMDNHMASML-QQHAKNGGALPYGP 223
            |:|..:.:....|     |.|:..|..|...|.|.  |...:...:.|:| ||||::..:....|
  Fly    73 RSPSDLGEQQQPPRQISRSPGNTAAYHLTTAMLLNSQQCGYLGQRLQSVLQQQHAQHQQSQSQTP 137

  Fly   224 PTPPGGQQPQVPNATPLHHGQQMGGQAGHATHAGHGHPTHHGHAPFGYHNAFGFGQGGHGYGHPE 288
            .:..|.|     :...:...::.||.|..:.              |...:..|..|.|.|.. |.
  Fly   138 SSDDGSQ-----SGVTILEEERRGGAAAASL--------------FTIDSILGSRQQGGGTA-PS 182

  Fly   289 EAAGNYLNSMHQMVEANQLQTG--ANGANPPPAPLPPSSF-------------------GSHQQH 332
            :.:....|.....:.:|.:..|  .:||..|.:|...||.                   |.|..|
  Fly   183 QGSHISSNGNQNGLTSNGISLGLKRSGAESPASPNSNSSSSAAASPIRPQRVPAMLQHPGLHLGH 247

  Fly   333 LAALAAQAQEQQNQHSKYAKSSPTG---AGPPPPPGAYFMESQTAPVAPSQINYDERSMSSASDL 394
            |||.||         |.:| :||:.   |.|...|. |...:..|.||                 
  Fly   248 LAAAAA---------SGFA-ASPSDFLVAYPNFYPN-YMHAAAVAHVA----------------- 284

  Fly   395 EEDDDDAAKLQLDVTSPPTPSPRGQLAAKRKSAGVFCDDNEPKLANGQLPGGNYGIRPRSMEEVH 459
                  ||::|..|:.              .:||:....:.|...:|               ..|
  Fly   285 ------AAQMQAHVSG--------------AAAGLSGHGHHPHHPHG---------------HPH 314

  Fly   460 HQQ-QSHHHQQQQQQQQQQQQLQQQQGFQHDFRNSGNGNPNGNSNSGDHGERLNADSDSLVNGSC 523
            |.. .:|||.                  ||...:.|:|.|                         
  Fly   315 HPHLGAHHHG------------------QHHLSHLGHGPP------------------------- 336

  Fly   524 ASSEDLNQTNSSEQGEKITSGSDDEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYS 588
                                            .|:.||:||.||..||.:||..|:|:|||||..
  Fly   337 --------------------------------PKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVL 369

  Fly   589 REELAMKVNLPEVRVQVWFQNRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGAS 642
            ||:||:||:|.|.||:|||:|||||||:|::.|..||......|      ||::
  Fly   370 REQLALKVDLKEERVEVWFKNRRAKWRKQKREEQERLRKLQEEQ------CGST 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 33/51 (65%)
OAR 876..892 CDD:281777
GscNP_001137762.2 Homeobox 343..396 CDD:278475 33/52 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.