DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and Pph13

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:386 Identity:111/386 - (28%)
Similarity:151/386 - (39%) Gaps:91/386 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   551 DDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWR 615
            |....|:|.||.||||.|.||.||||||:::|||||:.|||||::::|.|.||||||||||||||
  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66

  Fly   616 RQEK-------------------SESLRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALPGF 661
            :|||                   .:|..||     ||...||.|.:.||..|   |...::|...
  Fly    67 KQEKIGGLGGDYKEGALDLDVSYDDSAVLG-----QLDSALGGGGTLLPDTP---PQSSNSLDNE 123

  Fly   662 LSHPQ---TVYPSYLTPPLSLAPGNLTMSSLAAMGHHHAHNGPPPPHVG--HGGHG--QPQPPPP 719
            |....   .:.||.|:|.:.|   ||.:.                 |:|  .||.|  ......|
  Fly   124 LKASYGTGAMSPSRLSPNIFL---NLNID-----------------HLGLERGGSGLSMEWSTYP 168

  Fly   720 PPPHGVPHP---------------HGSH--HVVPLSHLSPHLSRMSPHATSLGSPHHGVTPLGTP 767
            |......||               |.|.  |....||   |..:...|.....:|.         
  Fly   169 PQTQAQTHPQMDSDNQLQQHPPQQHASDPIHAGSSSH---HQQQQQQHQQEQHNPQ--------- 221

  Fly   768 LHSSLPPSSTATTVAVSSSQSSSSSASLECSGPDVCMSPQNLSIGNADSNGDGRDLSSDLDA-GS 831
            ||   |....|.::::..:..||:...::....||    ...:|.:..::.......|.:.| |.
  Fly   222 LH---PGLEFAASLSLDMTDGSSAYDEMKFLSVDV----DQFTIDSFKADCILSMEQSQMQAYGG 279

  Fly   832 TSSNPGSSLDKCAASANIELLDVGRDSPPPPPTPTGKGSSTPPTDMRSNSIATLRIKAKEH 892
            .|...|||.:.|.....:....:....|..||:......|.|...:....||.|..:...|
  Fly   280 HSQLVGSSNELCLDGIGMSSFGMEEGEPKSPPSLLVLDKSLPSLSIGVEGIADLVEQLHHH 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 37/51 (73%)
OAR 876..892 CDD:281777 3/15 (20%)
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143142at50557
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.