DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and al

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:389 Identity:130/389 - (33%)
Similarity:178/389 - (45%) Gaps:89/389 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 TNSSEQGEKITSGSDDEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKV 596
            |||     .::.|:.|...|:...|:|.||.|||||::||.|||:||.::|||||::|||||||:
  Fly    63 TNS-----PVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKI 122

  Fly   597 NLPEVRVQVWFQNRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALPGF 661
            .|.|.|:||||||||||||:|||                   .|....|.:|:        |||.
  Fly   123 GLTEARIQVWFQNRRAKWRKQEK-------------------VGPQSHPYNPY--------LPGG 160

  Fly   662 LSHPQTVYPSYLTP-PLSLAPGNLT-------MSSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPP 718
            .:..|||..:.|.| |.:.....|.       .::|||..:.|....|..|   .|...|.|   
  Fly   161 AATMQTVVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIP---SGYFNQFQ--- 219

  Fly   719 PPPPHGVPHPHGSHHVVPLSHLSPHLSRMS--PHATSLGSPHHGVTP---LGTP-LHS-----SL 772
            ..|||.:||.....: .|.|.....|:.|:  |..|.||.|     |   :|:| |||     :.
  Fly   220 RAPPHMLPHGMAGMY-SPSSSFQSLLANMTAVPRGTPLGKP-----PALLVGSPDLHSPNHMLAS 278

  Fly   773 PPSSTATTVAVSSSQSSSSSASLECSGPDVCMSPQNLSIGNADSNGDGRDLSSDLDAGSTSSNPG 837
            ||:|.|:..|....|..::.       |....:|..:.:|...:     .||.....|...:...
  Fly   279 PPTSPASGHASQHQQHPTAH-------PPPPQAPPQMPVGVQPA-----QLSPQHLVGIALTQQA 331

  Fly   838 SSLD---------KCAASANIELLDVGRDSPPPPPTPTGKGSSTPPTDMRSNSIATLRIKAKEH 892
            |||.         ..:.|...:|......:|||||.     ::|||.|.|::|||.||:||:||
  Fly   332 SSLSPTQTSPVALTLSHSPQRQLPPPSHQAPPPPPR-----AATPPEDRRTSSIAALRLKAREH 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 37/51 (73%)
OAR 876..892 CDD:281777 9/15 (60%)
alNP_722629.1 Homeobox 89..141 CDD:278475 37/51 (73%)
OAR 374..391 CDD:281777 11/17 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143142at50557
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.