DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and rx2

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_571301.2 Gene:rx2 / 30473 ZFINID:ZDB-GENE-990415-237 Length:327 Species:Danio rerio


Alignment Length:304 Identity:128/304 - (42%)
Similarity:159/304 - (52%) Gaps:76/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 FCDDNEPKLANGQLPGGNYGIRPRSMEEVHHQQQS--HHHQQQQQQQQQQQQLQQQQG-FQHDFR 491
            |..|.:|.|.    |.|.:.:....:||...|..|  :.|.|...|.||||.:....| |..|..
Zfish    45 FSKDQDPLLE----PIGTHKVDEDQLEEQEKQVNSDPYSHLQIPDQTQQQQSVYHDTGLFSTDKC 105

  Fly   492 NSGNGNPNGNSNSGDHGERLNADSDSLVNGSCASSEDLNQTNSSEQGEKITSGSDDEGQDDNCAK 556
            ::..|:|           |.|.:|||       .|.|:                    .|::..|
Zfish   106 DADLGDP-----------RSNVESDS-------RSPDI--------------------PDEDQPK 132

  Fly   557 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSE 621
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.:
Zfish   133 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMD 197

  Fly   622 SLRLGL-----THFTQLP--HRLGCGASGLPVDPWLSPPLLSA-----LPGFLSHPQTVYPSYLT 674
            :..:.|     ..|.:.|  ..:|..::.||:|||||.||.||     :|||:...|::.|:|..
Zfish   198 TGTMKLHDSPIRSFNRPPMAPNVGPMSNSLPLDPWLSSPLSSATPMHSIPGFMGPGQSLQPTYTA 262

  Fly   675 PP--LSLAPGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHGQPQP 716
            .|  |:.:||  .|.::..|        ||||:       |.||
Zfish   263 HPGFLNTSPG--MMQNMQPM--------PPPPY-------QCQP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 51/51 (100%)
OAR 876..892 CDD:281777
rx2NP_571301.2 Octapeptide motif 37..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..73 7/28 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..139 18/76 (24%)
Homeobox 139..191 CDD:278475 51/51 (100%)
OAR 302..316 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 304..317
Nuclear localization signal. /evidence=ECO:0000255 310..314
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5546
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm25263
orthoMCL 1 0.900 - - OOG6_106944
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2565
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.