DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and Pitx3

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_062120.1 Gene:Pitx3 / 29609 RGDID:3332 Length:302 Species:Rattus norvegicus


Alignment Length:380 Identity:98/380 - (25%)
Similarity:141/380 - (37%) Gaps:148/380 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 CASSEDLNQTNSSEQGEKITSGSDDEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVY 587
            |...|   .::|.:....:..||.::|.    .|||.||.||.||:.||.|||..|:::.|||:.
  Rat    33 CKGQE---HSDSEKASASLPGGSPEDGS----LKKKQRRQRTHFTSQQLQELEATFQRNRYPDMS 90

  Fly   588 SREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDPWLSP 652
            :|||:|:..||.|.||:|||:|||||||::|:|:...|             |...       .:.
  Rat    91 TREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAEL-------------CKGG-------FAA 135

  Fly   653 PLLSALPGFLSHPQTVYPSYL---TPPLSLAPGNLTMSSLAAMGHHHAHN----GPPPPHVGHGG 710
            ||...:|.:    :.|||.|.   .||.:|||      .|||.....|.|    ||..       
  Rat   136 PLGGLVPPY----EEVYPGYTYGNWPPKALAP------PLAAKTFPFAFNSVNVGPLA------- 183

  Fly   711 HGQP--QPPPPPPPHGVPHPHGSHHVVPLSHLSPHLSRMSPHA-TSLGSPHHGVTPLGTPLHSSL 772
             .||  .||.......||....:...||           .|.| ..||....|:.|         
  Rat   184 -SQPVFSPPSSIAASMVPSAAAAPGTVP-----------GPGALQGLGGAPPGLAP--------- 227

  Fly   773 PPSSTATTVAVSSSQSSSSSASLECSGPDVCMSPQNLSIGNADSNGDGRDLSSDLDAGSTSSNPG 837
               :..::.|||...:|:::|                                   |.:.:|:|.
  Rat   228 ---AAVSSGAVSCPYASAAAA-----------------------------------AAAAASSPY 254

  Fly   838 SSLDKCAASANIELLDVGRDSPPPPPTPTGKGSSTPPTDMRSNSIATLRIKAKEH 892
            ...|.|                                   ::|:|:||:|||:|
  Rat   255 VYRDPC-----------------------------------NSSLASLRLKAKQH 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 30/51 (59%)
OAR 876..892 CDD:281777 7/15 (47%)
Pitx3NP_062120.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 14/44 (32%)
Homeobox 66..119 CDD:395001 31/52 (60%)
PTZ00395 <142..>236 CDD:185594 32/134 (24%)
OAR 258..275 CDD:397759 10/52 (19%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 262..275 8/13 (62%)
Nuclear localization signal. /evidence=ECO:0000255 268..272 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.