DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and sebox

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_001306981.1 Gene:sebox / 282666 ZFINID:ZDB-GENE-021206-4 Length:293 Species:Danio rerio


Alignment Length:369 Identity:83/369 - (22%)
Similarity:118/369 - (31%) Gaps:125/369 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   511 LNADSDSLVNGSCASSEDLNQTNSSEQGEKITSGSDDEGQDDNCAKKKHRRNRTTFTTYQLHELE 575
            :..:||.:.|.:.....|:...:.....|...:| ..|||        .:|.||.|:..||.|||
Zfish    19 METESDFIFNTNMLQFTDVTTKHMLSSPELDRTG-HVEGQ--------RKRKRTIFSRAQLSELE 74

  Fly   576 RAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQ----------------------- 617
            |||..:.|||:..||.||....|||.::|||||||||:..:.                       
Zfish    75 RAFMITPYPDITLRERLAALTLLPESKIQVWFQNRRARSMKSKKLITPVSRRSPAKDCTFPATHP 139

  Fly   618 ----EKSESLRLGLTHFTQLPHRLGCGASGLPVDPWLS--PPLLSALPGFLSHPQTVYPSYLTPP 676
                |:|......|.|..|...|..       ::||..  ||:...||..|.....         
Zfish   140 DLNLEQSPEANKSLRHHQQSLIRQA-------LNPWPQNRPPISPDLPEILQWANR--------- 188

  Fly   677 LSLAPGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPPPPPHGVPHPHGSHHVVPLSHLS 741
            .|..||:.:.||.            |...:.|                 |.|:.|..|..::..:
Zfish   189 NSETPGDSSFSSC------------PSERIQH-----------------PFPNQSSSVWQMNCFA 224

  Fly   742 PHLSRMSPHATSLGSPHHGVTPLGTPLHSSLPPSSTATTVAVSSSQSSSSSASLECSGPDVCMSP 806
            .|...:..:.|                          |:.|:.||.|.........|..:..:..
Zfish   225 AHPEGLKSYCT--------------------------TSQALYSSVSVDQMIPAHPSSLEEALQR 263

  Fly   807 QNLSIGNADSNGDGRDLSSDLDAGSTSSNPGSSLDKCAASANIE 850
            |.|:.....|.||..||                :.|.|...|:|
Zfish   264 QALTHYPQTSLGDISDL----------------IYKAAVVTNLE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 30/51 (59%)
OAR 876..892 CDD:281777
seboxNP_001306981.1 COG5576 13..159 CDD:227863 44/148 (30%)
Homeobox 61..112 CDD:278475 29/50 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..144 0/26 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.