DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and ALX3

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_006483.2 Gene:ALX3 / 257 HGNCID:449 Length:343 Species:Homo sapiens


Alignment Length:417 Identity:111/417 - (26%)
Similarity:159/417 - (38%) Gaps:112/417 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 SPTGAGPPPPPGAYFMESQTAPVAPSQINYDERSMSSASDLEEDDDDAAKLQLDVTSPPTPSPRG 418
            :|...||.|.|   ::.|...|..|      :.:.::|..|.                |.| |||
Human     7 APFRVGPAPGP---YVASGDEPPGP------QGTPAAAPHLH----------------PAP-PRG 45

  Fly   419 QLAAKRKSAGVFCDDNEPKLANGQLPGGNY----GIRPRSMEEVHHQQQSHHHQQQQQQQQQQQQ 479
                .|.:....|...||.|.....|...|    |..| ::...|..:.....:::..:.....|
Human    46 ----PRLTRFPACGPLEPYLPEPAKPPAKYLQDLGPGP-ALNGGHFYEGPAEAEEKTSKAASFPQ 105

  Fly   480 LQQQ-QGFQHDFRNSGNGNPNGNSNSGDHGERLNADSDSLVNGSCASSEDLNQTNSSEQGEKITS 543
            |... :|...|..::..|:|                      |.|.:|..|..:.......::..
Human   106 LPLDCRGGPRDGPSNLQGSP----------------------GPCLASLHLPLSPGLPDSMELAK 148

  Fly   544 GSDDEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQ 608
            .           |.|.|||||||:|:||.|||:.|:|:||||||:||:||::.:|.|.|||||||
Human   149 N-----------KSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQ 202

  Fly   609 NRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALPGFLSHPQTVYPSYL 673
            |||||||::|:...::.|...||....                   :|.||...||||.....:.
Human   203 NRRAKWRKRERYGKIQEGRNPFTAAYD-------------------ISVLPRTDSHPQLQNSLWA 248

  Fly   674 TP-------PLSLAPGNLTMSSLAAMGHHH----AHNGPPPPHVGHGGHGQPQPPPPPPPHGVPH 727
            :|       |..::|..:....::...|.|    ...|.|.|...|        |.....||.|.
Human   249 SPGSGSPGGPCLVSPEGIPSPCMSPYSHPHGSVAGFMGVPAPSAAH--------PGIYSIHGFPP 305

  Fly   728 PHGSHHVVPLS---HLSPHL--SRMSP 749
            ..|.|...|.|   :.||.|  .|:.|
Human   306 TLGGHSFEPSSDGDYKSPSLVSLRVKP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 36/51 (71%)
OAR 876..892 CDD:281777
ALX3NP_006483.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 25/127 (20%)
PRK12323 <13..131 CDD:237057 31/170 (18%)
Homeobox 157..210 CDD:365835 37/52 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.