DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and Drgx

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_665710.2 Gene:Drgx / 252880 RGDID:628616 Length:263 Species:Rattus norvegicus


Alignment Length:352 Identity:101/352 - (28%)
Similarity:134/352 - (38%) Gaps:129/352 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   544 GSDDEGQ-DDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWF 607
            |:...|. ||...::|.||||||||..||..||..|.::|||||::|||||||:||.|.||||||
  Rat    17 GNHSTGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWF 81

  Fly   608 QNRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALPGFLSHPQTVYPSY 672
            ||||||||:.|:                    |||  ..:|....|:....|             
  Rat    82 QNRRAKWRKTER--------------------GAS--DQEPGAKEPMAEVTP------------- 111

  Fly   673 LTPPLSLAPGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPPPPPHGVPHPHGSHHVVPL 737
              ||:.    |:              |.|||   |....|:.:.                     
  Rat   112 --PPVR----NI--------------NSPPP---GDQARGKKEA--------------------- 132

  Fly   738 SHLSPHLSRMSPHATSLGSPHHGVTPLGTPLHSSLPPS--STATTVAVSSSQSSSSSASLE---- 796
                  |....    |||   ..|.|.|....|.||.:  :|||     .:|:.|..|||:    
  Rat   133 ------LEAQQ----SLG---RTVGPAGPFFPSCLPGTLLNTAT-----YAQALSHVASLKGGPL 179

  Fly   797 --CSGPDV----------CMSPQNLSIG----NADSNGDGRDLSSDLDAGSTSSNPGSSLDKCAA 845
              |..||.          |.|.:..|:.    .|..:.:....|::| ..||||:||        
  Rat   180 CSCCVPDPMGLSFLPTYGCQSNRTASVAALRMKAREHSEAVLQSANL-LPSTSSSPG-------- 235

  Fly   846 SANIELLDVGRDSPPPPPTPTGKGSST 872
            .|:.::...|....|.|.....:|..:
  Rat   236 PASKQVPPEGSQDKPSPTKEQSEGEKS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 37/51 (73%)
OAR 876..892 CDD:281777
DrgxNP_665710.2 Homeobox 37..90 CDD:395001 38/52 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..135 19/131 (15%)
OAR 201..218 CDD:397759 2/16 (13%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 204..217 2/12 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..263 13/53 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.