DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and ceh-8

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_492246.2 Gene:ceh-8 / 191617 WormBaseID:WBGene00000433 Length:276 Species:Caenorhabditis elegans


Alignment Length:307 Identity:99/307 - (32%)
Similarity:122/307 - (39%) Gaps:102/307 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 NPNGNSNSGDHGERLNADSDSLVNGSCASS----EDLNQTNSSEQGEKITSGSDDEGQDDNCAKK 557
            ||..|:         :|.|....|.|..||    :..:..:|.|.....:..|......|..|.|
 Worm     3 NPTDNN---------SATSSITPNFSAFSSFTTYKPSDSFSSFESDSSPSKSSSSRKNRDKIADK 58

  Fly   558 KHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSES 622
            |.|||||||||:|||.||.||:|:||||||:||.||.||.||||||||||||||||:|||||.:.
 Worm    59 KQRRNRTTFTTFQLHALEAAFDKTHYPDVYARETLAAKVQLPEVRVQVWFQNRRAKFRRQEKQDC 123

  Fly   623 LRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALPGFLSHPQTVYPSYLTPPLSLAPGNLTMS 687
            .       .:..|.|   ...:|...|:|.....                 |||: |.|.| |:|
 Worm   124 Q-------GEEKHSL---KDTMPSWSWMSENKTD-----------------TPPM-LPPAN-TLS 159

  Fly   688 SL----------------AAMGHHHAHNGPPP--PHVGHGGH----------------GQPQPP- 717
            |.                ...|...|..|.|.  .||...|:                ..||.| 
 Worm   160 STHNNGISDEFFKTSEGKEVYGFPFAEYGTPADNTHVSKTGNVFHLNFEDSDKKSMKKESPQTPS 224

  Fly   718 ----------PPPPPHGVPH--------------PHGSHHVVP-LSH 739
                      ||..|:.:|:              |:..|...| |:|
 Worm   225 TSSPFISEYHPPFIPYYIPNQSFSNAFNQYPMPFPYPIHFEPPQLTH 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 42/51 (82%)
OAR 876..892 CDD:281777
ceh-8NP_492246.2 Homeobox 64..116 CDD:278475 42/51 (82%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4307
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - oto19678
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2565
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.