Sequence 1: | NP_726006.3 | Gene: | Rx / 37367 | FlyBaseID: | FBgn0020617 | Length: | 904 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492246.2 | Gene: | ceh-8 / 191617 | WormBaseID: | WBGene00000433 | Length: | 276 | Species: | Caenorhabditis elegans |
Alignment Length: | 307 | Identity: | 99/307 - (32%) |
---|---|---|---|
Similarity: | 122/307 - (39%) | Gaps: | 102/307 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 497 NPNGNSNSGDHGERLNADSDSLVNGSCASS----EDLNQTNSSEQGEKITSGSDDEGQDDNCAKK 557
Fly 558 KHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSES 622
Fly 623 LRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALPGFLSHPQTVYPSYLTPPLSLAPGNLTMS 687
Fly 688 SL----------------AAMGHHHAHNGPPP--PHVGHGGH----------------GQPQPP- 717
Fly 718 ----------PPPPPHGVPH--------------PHGSHHVVP-LSH 739 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rx | NP_726006.3 | Homeobox | 563..615 | CDD:278475 | 42/51 (82%) |
OAR | 876..892 | CDD:281777 | |||
ceh-8 | NP_492246.2 | Homeobox | 64..116 | CDD:278475 | 42/51 (82%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 102 | 1.000 | Domainoid score | I4307 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D454642at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 1 | 1.000 | - | - | oto19678 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2565 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.950 |