DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and Pitx3

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:XP_006526827.1 Gene:Pitx3 / 18742 MGIID:1100498 Length:388 Species:Mus musculus


Alignment Length:380 Identity:98/380 - (25%)
Similarity:141/380 - (37%) Gaps:148/380 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 CASSEDLNQTNSSEQGEKITSGSDDEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVY 587
            |...|   .::|.:....:..||.::|.    .|||.||.||.||:.||.|||..|:::.|||:.
Mouse   119 CKGQE---HSDSEKASASLPGGSPEDGS----LKKKQRRQRTHFTSQQLQELEATFQRNRYPDMS 176

  Fly   588 SREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDPWLSP 652
            :|||:|:..||.|.||:|||:|||||||::|:|:...|             |...       .:.
Mouse   177 TREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAEL-------------CKGG-------FAA 221

  Fly   653 PLLSALPGFLSHPQTVYPSYL---TPPLSLAPGNLTMSSLAAMGHHHAHN----GPPPPHVGHGG 710
            ||...:|.:    :.|||.|.   .||.:|||      .|||.....|.|    ||..       
Mouse   222 PLGGLVPPY----EEVYPGYSYGNWPPKALAP------PLAAKTFPFAFNSVNVGPLA------- 269

  Fly   711 HGQP--QPPPPPPPHGVPHPHGSHHVVPLSHLSPHLSRMSPHA-TSLGSPHHGVTPLGTPLHSSL 772
             .||  .||.......||....:...||           .|.| ..||....|:.|         
Mouse   270 -SQPVFSPPSSIAASMVPSAAAAPGTVP-----------GPGALQGLGGAPPGLAP--------- 313

  Fly   773 PPSSTATTVAVSSSQSSSSSASLECSGPDVCMSPQNLSIGNADSNGDGRDLSSDLDAGSTSSNPG 837
               :..::.|||...:|:::|                                   |.:.:|:|.
Mouse   314 ---AAVSSGAVSCPYASAAAA-----------------------------------AAAAASSPY 340

  Fly   838 SSLDKCAASANIELLDVGRDSPPPPPTPTGKGSSTPPTDMRSNSIATLRIKAKEH 892
            ...|.|                                   ::|:|:||:|||:|
Mouse   341 VYRDPC-----------------------------------NSSLASLRLKAKQH 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 30/51 (59%)
OAR 876..892 CDD:281777 7/15 (47%)
Pitx3XP_006526827.1 Homeobox 152..205 CDD:365835 31/52 (60%)
PTZ00395 <228..>322 CDD:185594 32/134 (24%)
OAR 344..361 CDD:367680 10/52 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.