DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and ceh-53

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_500361.3 Gene:ceh-53 / 182467 WormBaseID:WBGene00015651 Length:203 Species:Caenorhabditis elegans


Alignment Length:248 Identity:66/248 - (26%)
Similarity:97/248 - (39%) Gaps:76/248 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 LVNGSCASSEDLNQTNSSEQGEKITSGSDDEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSH 582
            :|...|:||...:..||.|                    ::.||.||.|:..||..||.||.|..
 Worm    10 MVMKECSSSPPQSAQNSEE--------------------RRVRRLRTAFSENQLELLEEAFLKCQ 54

  Fly   583 YPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVD 647
            ||||..||.|..:..|.|.|:||||:|||||.|:::::||.....|  |:..:..|.....|...
 Worm    55 YPDVQQRETLGKQTELAEARIQVWFKNRRAKARKRQRNESTDSCST--TEESNEEGDADGCLKKK 117

  Fly   648 PWLSPPLLSALPGFLSHPQTVYPSYLTPPLSLAPGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHG 712
            ......:::..||     ..::.|.|:|         |.:|:                       
 Worm   118 AKNETTIITWTPG-----AALFNSSLSP---------TTTSI----------------------- 145

  Fly   713 QPQPPPPPPP-----HGVP----HPHGSHHVVPLSHLSPHLSRMSPHATSLGS 756
               |..|.||     |..|    :|:.:.:.:|     .||...:..|.|:||
 Worm   146 ---PTTPAPPLNFICHQNPFYAYNPYRNLNTIP-----THLLAATTTAASIGS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 29/51 (57%)
OAR 876..892 CDD:281777
ceh-53NP_500361.3 Homeobox 35..81 CDD:365835 24/45 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.