DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and Phox2a

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_032913.1 Gene:Phox2a / 11859 MGIID:106633 Length:280 Species:Mus musculus


Alignment Length:213 Identity:77/213 - (36%)
Similarity:99/213 - (46%) Gaps:79/213 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   556 KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKS 620
            |:|.||.|||||:.||.||||.|.::||||:|:|||||:|::|.|.||||||||||||:|:||::
Mouse    87 KRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERA 151

  Fly   621 ESLRLGLTHFTQLPHRLGCGASGL--------------------PVDPWLSPPLLSALPGFLSHP 665
            .|.:               ||:|.                    ...|  :|...::||      
Mouse   152 ASAK---------------GAAGATGAKKGEARCSSEDDDSKESTCSP--TPDSTASLP------ 193

  Fly   666 QTVYPSYLTPPL-SLAPGNLTMSSL-AAMGHHHAHNGPPPPHV-----------GHGGHG----- 712
                    .||. |||...|:.|.| ||:|     :||.|..:           |.||.|     
Mouse   194 --------PPPAPSLASPRLSPSPLPAALG-----SGPGPQPLKGALWAGVAGGGGGGPGTGAAE 245

  Fly   713 -----QPQPPPPPPPHGV 725
                 ||..|.|.|..||
Mouse   246 LLKAWQPAEPGPGPFSGV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 37/51 (73%)
OAR 876..892 CDD:281777
Phox2aNP_032913.1 Homeobox 94..147 CDD:395001 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..244 29/134 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..280 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.