Sequence 1: | NP_726006.3 | Gene: | Rx / 37367 | FlyBaseID: | FBgn0020617 | Length: | 904 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032913.1 | Gene: | Phox2a / 11859 | MGIID: | 106633 | Length: | 280 | Species: | Mus musculus |
Alignment Length: | 213 | Identity: | 77/213 - (36%) |
---|---|---|---|
Similarity: | 99/213 - (46%) | Gaps: | 79/213 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 556 KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKS 620
Fly 621 ESLRLGLTHFTQLPHRLGCGASGL--------------------PVDPWLSPPLLSALPGFLSHP 665
Fly 666 QTVYPSYLTPPL-SLAPGNLTMSSL-AAMGHHHAHNGPPPPHV-----------GHGGHG----- 712
Fly 713 -----QPQPPPPPPPHGV 725 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rx | NP_726006.3 | Homeobox | 563..615 | CDD:278475 | 37/51 (73%) |
OAR | 876..892 | CDD:281777 | |||
Phox2a | NP_032913.1 | Homeobox | 94..147 | CDD:395001 | 37/52 (71%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 145..244 | 29/134 (22%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 260..280 | 2/4 (50%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |