DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and Rax

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_446130.1 Gene:Rax / 114213 RGDID:620371 Length:342 Species:Rattus norvegicus


Alignment Length:436 Identity:133/436 - (30%)
Similarity:154/436 - (35%) Gaps:210/436 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 PNGNSNSGDHGERLNADSDSLVNGSCASSEDLNQTNSSEQGEKITS---------GSDDEGQDDN 553
            |.|.|.|          |.....|.....|........||||...|         |.....:::.
  Rat    77 PAGGSES----------SPPAAPGLVPEFEATRPCYPKEQGEARPSPGLPVGPAAGDSKLSEEEE 131

  Fly   554 CAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQE 618
            ..||||||||||||||||||||||||||||||||||||||.||||||||||||||||||||||||
  Rat   132 PPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQE 196

  Fly   619 KSE--SLRL---GLTHFTQLPHR-----LGCGASG-------LPVDPWLSPPL-------LSALP 659
            |.|  |::|   .|..|::.|..     ||...||       ||::|||.|||       |.:||
  Rat   197 KLEVSSMKLQDSPLLSFSRSPPSSALAPLGGPGSGSGPPGSALPLEPWLGPPLPGGGATALQSLP 261

  Fly   660 GFLSHPQTVYPSYLTPPLSLAPGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPPPPP-- 722
            ||                                      |||       |.|.|....||||  
  Rat   262 GF--------------------------------------GPP-------GQGLPASYTPPPPFL 281

  Fly   723 HGVPHPHGSHHVVPLSHLSPHLSRMSPHATSLGSPHHGVTPLGTPLHSSLPPSSTATTVAVSSSQ 787
            :..|             |.|.|.::.|                       ||       |...:.
  Rat   282 NSAP-------------LGPGLQQLGP-----------------------PP-------AYPCAP 303

  Fly   788 SSSSSASLECSGPDVCMSPQNLSIGNADSNGDGRDLSSDLDAGSTSSNPGSSLDKCAASANIELL 852
            :.....|||.:.|                                                    
  Rat   304 AFGDKFSLEEAYP---------------------------------------------------- 316

  Fly   853 DVGRDSPPPPPTPTGKGSSTPPTDMRSNSIATLRIKAKEHLDNLNK 898
                                     |::|||.||:|||||:..:.|
  Rat   317 -------------------------RNSSIAALRLKAKEHIQAIGK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 50/51 (98%)
OAR 876..892 CDD:281777 9/15 (60%)
RaxNP_446130.1 Octapeptide motif 33..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..141 19/73 (26%)
Homeobox 141..193 CDD:278475 50/51 (98%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..295 34/143 (24%)
OAR 316..331 CDD:281777 10/91 (11%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 319..332 9/12 (75%)
Nuclear localization signal. /evidence=ECO:0000255 325..329 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I5679
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - oto98662
orthoMCL 1 0.900 - - OOG6_106944
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.