DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and rax2

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:XP_002941436.1 Gene:rax2 / 100494721 XenbaseID:XB-GENE-494483 Length:227 Species:Xenopus tropicalis


Alignment Length:384 Identity:119/384 - (30%)
Similarity:153/384 - (39%) Gaps:180/384 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 EDLNQTNSSEQGEKITSGSDDEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREE 591
            |||  .:..|.|...|.|: .||:|:...||||||||||||||||||||||||:|||||||||||
 Frog     7 EDL--CDLREDGSTPTPGT-PEGEDNELPKKKHRRNRTTFTTYQLHELERAFERSHYPDVYSREE 68

  Fly   592 LAMKVNLPEVRVQVWFQNRRAKWRRQEKSE--SLRL---GLTHFTQLPHRLGCG--ASGLPVDPW 649
            |||||:||||||||||||||||||||||.|  |.:|   .|..|::.|...|.|  ::.||::||
 Frog    69 LAMKVSLPEVRVQVWFQNRRAKWRRQEKLETSSSKLHDSPLLSFSRSPMATGVGPLSNTLPLEPW 133

  Fly   650 LSPPL-----LSALPGFLSHPQTVYPSYLTPPLSLAPGNLTMSSLAAMGHHHAHNGPPPPHVGHG 709
            |:.|:     :.::|.|::..|.:.|:|                   ..|...::|||       
 Frog   134 LTSPIPGTTTVHSMPAFMAPSQALQPTY-------------------QSHTFLNSGPP------- 172

  Fly   710 GHGQPQPPPPPPPHGVPHPHGSHHVVPLSHLSPHLSRMSPHATSLGSPHHGVTPLGTPLHSSLPP 774
                                    :.|:..||             |:|:.               
 Frog   173 ------------------------MTPIQPLS-------------GAPYQ--------------- 185

  Fly   775 SSTATTVAVSSSQSSSSSASLECSGPDVCMSPQNLSIGNADSNGDGRDLSSDLDAGSTSSNPGSS 839
                                        ||                                |..
 Frog   186 ----------------------------CM--------------------------------GGF 190

  Fly   840 LDKCAASANIELLDVGRDSPPPPPTPTGKGSSTPPTDMRSNSIATLRIKAKEHLDNLNK 898
            :||....                           ..|.||:|||.||:|||||:..::|
 Frog   191 MDKFPLE---------------------------EMDQRSSSIAALRMKAKEHIQTIDK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 49/51 (96%)
OAR 876..892 CDD:281777 11/15 (73%)
rax2XP_002941436.1 Homeobox 40..93 CDD:365835 50/52 (96%)
OAR 200..216 CDD:367680 11/15 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm49413
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2565
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.