DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rx and alx1

DIOPT Version :9

Sequence 1:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:XP_002931669.1 Gene:alx1 / 100489661 XenbaseID:XB-GENE-853095 Length:326 Species:Xenopus tropicalis


Alignment Length:371 Identity:89/371 - (23%)
Similarity:132/371 - (35%) Gaps:156/371 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 NQTNSSEQGEKITSGSDDEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAM 594
            ::.:..|.|:|.         |.|.:..|.||:|||||:.||.|||:.|:|:||||||.||:||:
 Frog   112 DKVDLDELGDKC---------DSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLAL 167

  Fly   595 KVNLPEVRVQVWFQNRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALP 659
            :..|.|.||||||||||||||::|:...::...:||.....                   :|.||
 Frog   168 RTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYD-------------------ISVLP 213

  Fly   660 GFLSHPQTVYPSYLTPPLSLAPGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPPPPPHG 724
            ...|:||.....:...|   :.|::..|.:.                          |..|....
 Frog   214 RADSYPQIQNNLWAGNP---SGGSVVTSCML--------------------------PREPSACM 249

  Fly   725 VPHPHGSHHVVPLSHLSPHLSRMSPHATSLGSPHHGVTPLGTPLHSSLPPSSTATTVAVSSSQSS 789
            .|:.|.:....|.:..:.|.::.|          |      .||::....|              
 Frog   250 TPYSHSTRTDSPYTSFTNHQNQFS----------H------VPLNNFFTES-------------- 284

  Fly   790 SSSASLECSGPDVCMSPQNLSIGNADSNGDGRDLSSDLDAGSTSSNPGSSLDKCAASANIELLDV 854
                                                 |.:||.:   |.|.:             
 Frog   285 -------------------------------------LLSGSAN---GHSFE------------- 296

  Fly   855 GRDSPPPPPTPTGKGSSTPPTDMRSNSIATLRIKAKEHLDNLNKGM 900
                            :.|..:.||:|||.||:|||||..|::..|
 Frog   297 ----------------AKPEFERRSSSIAVLRMKAKEHTANISWAM 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 36/51 (71%)
OAR 876..892 CDD:281777 10/15 (67%)
alx1XP_002931669.1 Homeobox 135..189 CDD:365835 37/53 (70%)
OAR 302..320 CDD:367680 12/17 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 149 1.000 Inparanoid score I4275
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.