DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and ACA8

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_200444.1 Gene:ACA8 / 835733 AraportID:AT5G56330 Length:350 Species:Arabidopsis thaliana


Alignment Length:257 Identity:61/257 - (23%)
Similarity:98/257 - (38%) Gaps:76/257 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SYNYDWDQGPHTWDT------AC---NNQSPINI-DMNCVEINYFDTPLIWSHYNSIPLGIRLEN 135
            ||....::||..|.|      .|   ..||||:: |.|.|..|.|.  |:.|.|  :|....::|
plant   141 SYETKGNKGPAKWGTLDAEWKMCGIGKMQSPIDLRDKNVVVSNKFG--LLRSQY--LPSNTTIKN 201

  Fly   136 NGHTLILRAAFPERTPSIDGGDLLG-RFDFREISFRWSWASSLGSEHTLDHHHSPLEMQCLHTDG 199
            .||.::|:  |......| |..:.| |:..:::    .|.|.  ||||::.....||...:|.  
plant   202 RGHDIMLK--FKGGNKGI-GVTIRGTRYQLQQL----HWHSP--SEHTINGKRFALEEHLVHE-- 255

  Fly   200 DGCDGCSSSQGVLMISYMFDLSEHNPFLDVLIQHLAAVEQAGQVVEVPPFPLSYLMSPFYDKFYS 264
                  |..:...:::::::|...:|||..|.:.|..:...                        
plant   256 ------SKDKRYAVVAFLYNLGASDPFLFSLEKQLKKITDT------------------------ 290

  Fly   265 YNGSLTEPPCHRGAEWLIYPESLAISERQLNEFR-QLRDRRGSRIARNARPVQPIGDRMVYL 325
                      |...|.:     ..:|.:|:...| .:.|...|    ||||:|.:..|.|||
plant   291 ----------HASEEHI-----RTVSSKQVKLLRVAVHDASDS----NARPLQAVNKRKVYL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 58/254 (23%)
ACA8NP_200444.1 alpha_CA_prokaryotic_like 149..333 CDD:239398 57/247 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.