DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and ACA6

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_193832.1 Gene:ACA6 / 827847 AraportID:AT4G21000 Length:260 Species:Arabidopsis thaliana


Alignment Length:213 Identity:49/213 - (23%)
Similarity:90/213 - (42%) Gaps:38/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SYNYDWDQGPHTWD------TACNN---QSPINIDMNCVEINYFDTPLIWSHYNSIPLGIRLENN 136
            :|....::||..|.      ..|:.   |||  ||:....::......:..||.  |....:::.
plant    38 TYKQKTEKGPAEWGKLDPQWKVCSTGKIQSP--IDLTDERVSLIHDQALSKHYK--PASAVIQSR 98

  Fly   137 GHTLILRAAFPERTPSIDGGDL-LGRFDFREISFRWSWASSLGSEHTLDHHHSPLEMQCLHTDGD 200
            ||.:::       :...|||.: :.:.|::.:...|    ...||||::.....||:..:||   
plant    99 GHDVMV-------SWKGDGGKITIHQTDYKLVQCHW----HSPSEHTINGTSYDLELHMVHT--- 149

  Fly   201 GCDGCSSSQGVLMISYMFDLSEHNPFLDVLIQHLAAV-EQAGQVVEVPPFPLSYLMSPFYDKFYS 264
                 |:|....::..::.|.|.:.||..::..:..| ::...:..|.|..:.:..    :.||.
plant   150 -----SASGKTTVVGVLYKLGEPDEFLTKILNGIKGVGKKEIDLGIVDPRDIRFET----NNFYR 205

  Fly   265 YNGSLTEPPCHRGAEWLI 282
            |.||||.|||..|..|.:
plant   206 YIGSLTIPPCTEGVIWTV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 49/212 (23%)
ACA6NP_193832.1 PLN02179 1..235 CDD:177835 49/213 (23%)
alpha_CA_prokaryotic_like 46..225 CDD:239398 48/205 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.