DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and car1_predicted

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001072785.1 Gene:car1_predicted / 780246 -ID:- Length:258 Species:Xenopus tropicalis


Alignment Length:237 Identity:69/237 - (29%)
Similarity:109/237 - (45%) Gaps:15/237 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 NNQSPINIDMNCVEINYFDTPLIWSHYNSIPLGIRLENNGHTLILRAAFPERTPS--IDGGDLLG 160
            ::||||||:....:.|....||.:|:  ......|:.|.||  .....|.:....  :..|.|.|
 Frog    14 HHQSPININTRTAKYNPSLKPLKFSY--DPKTAKRIVNVGH--CFNVEFEDICDKSVLSEGPLDG 74

  Fly   161 RFDFREISFRWSWASSLGSEHTLDHHHSPLEMQCLHTDG----DGCDGCSSSQGVLMISYMFDLS 221
            .:...:..|.|..:...||||.:|.|..|.|:..:|.:.    ...:......||.::.....|.
 Frog    75 HYRLCQFHFHWGSSDRDGSEHNIDGHLYPAELHIVHWNSKKYTSFAEAAKHPDGVAVVGVFLKLG 139

  Fly   222 EHNPFLDVLIQHLAAVEQAGQVVEVPPFPLSYLMSPFYDKFYSYNGSLTEPPCHRGAEWLIYPES 286
            ..||.|..:|::|..|:..|:......|.|:.|: |....:::|.||||..|......|:|..|:
 Frog   140 NTNPALQSIIENLDKVKTKGKACPFTEFHLNGLL-PEDLNYWTYMGSLTTKPYFECVTWIILQEA 203

  Fly   287 LAISERQLNEFRQLR----DRRGSRIARNARPVQPIGDRMVY 324
            :.:|.:||.:||:|:    :...|.|..|.|||||:..|:||
 Frog   204 ITVSSQQLEQFRRLQCTSENENPSFILENHRPVQPLDHRVVY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 69/237 (29%)
car1_predictedNP_001072785.1 alpha_CA 16..247 CDD:381753 69/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.