DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and zgc:153760

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001070086.1 Gene:zgc:153760 / 767680 ZFINID:ZDB-GENE-060929-528 Length:324 Species:Danio rerio


Alignment Length:272 Identity:67/272 - (24%)
Similarity:118/272 - (43%) Gaps:37/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DQGPHTW---DTACN---------------NQSPINIDMNCVEINYFDTPLIWSHYNSIPLGIRL 133
            |..|..|   :.|||               :||||:|....|:.|...|..|.:.:::......:
Zfish    20 DNLPVAWCYNNPACNFPNWPNIAPQYCNGSSQSPIDIVTAQVQGNPNLTQFILTGFDANTTFTSI 84

  Fly   134 ENNGHTLILRAAFPERTPSIDGGDLLGRFDFREISFRWSWASSL-GSEHTLDHHHSPLEMQC--L 195
            .|:|.::::  :..|...|:.||||.|.:...:....|..:||| |||||:|.....:|:..  |
Zfish    85 TNSGTSVVV--SLDEDIMSVQGGDLPGLYVSVQFHLHWGSSSSLPGSEHTVDGKQYAMELHIVNL 147

  Fly   196 HTDGDG----CDGCSSSQGVLMISYMF---DLSEHNPFLDVLIQHLAAVEQAGQVVE--VPPFPL 251
            |:..:|    ....:.|..:.::.:..   |.::.....||....|:.:..:|....  :....:
Zfish   148 HSTYNGNVSAALAANDSSALAVLGFFIEGTDEADKTNSWDVFTSFLSNIPNSGNTYTDIMDQITM 212

  Fly   252 SYLMSPF-YDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEFRQ---LRDRRGSRI-ARN 311
            :.|:... ..|:|.|.||||.|||:....|.::.|.:.::...:|.|..   .:..:.|.: ..|
Zfish   213 NSLLEGVNKTKYYRYQGSLTTPPCNEDVIWTVFKEPIKVNNNLINRFCTKVFAKTAKASDLNVNN 277

  Fly   312 ARPVQPIGDRMV 323
            .|.|||:..|:|
Zfish   278 FRGVQPLNGRVV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 67/272 (25%)
zgc:153760NP_001070086.1 alpha_CA_IV_XV_like 48..291 CDD:239391 61/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579196
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.