DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and CA6

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_011540386.1 Gene:CA6 / 765 HGNCID:1380 Length:324 Species:Homo sapiens


Alignment Length:276 Identity:69/276 - (25%)
Similarity:111/276 - (40%) Gaps:34/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LRGSPESYNYDWDQGPHTWD--------TAC--NNQSPINIDMNCVEINYFDTPLIWSHYNSIPL 129
            |.|....:..||.......|        .||  ..|||||:....|..|.....|..:.|.:...
Human    16 LLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAG 80

  Fly   130 GIRLENNGHTLILRAAFPERTPSIDGGDLLGRFDFREISFRWSWASS--LGSEHTLDHHHSPLEM 192
            ...:.|||||:.:......|....||...:.    :::.|.|..|||  .|||||:|.....:|:
Human    81 EFPMVNNGHTVQISLPSTMRMTVADGTVYIA----QQMHFHWGGASSEISGSEHTVDGIRHVIEI 141

  Fly   193 QCLHTDG---------DGCDGCSSSQGVLMISYMFDLSEH--NPFLDVLIQHLAAVEQAGQVVEV 246
            ..:|.:.         |..|      |:.:::...::..:  |.:....|.|||.::..||...:
Human   142 HIVHYNSKYKSYDIAQDAPD------GLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTL 200

  Fly   247 PPFPLSYLMSPFYDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEF-RQLRDRRGSRIAR 310
            ....:..::......:|:|:||||.|||.....|.:..:.:.:|..|:.:. ..|.|.|...|..
Human   201 TGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHN 265

  Fly   311 NARPVQPIGDRMVYLN 326
            :.|..||:..|:|..|
Human   266 DYRRTQPLNHRVVESN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 66/266 (25%)
CA6XP_011540386.1 alpha_CA_VI 35..283 CDD:239399 65/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145771
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.