DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and Car10

DIOPT Version :10

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_082572.1 Gene:Car10 / 72605 MGIID:1919855 Length:328 Species:Mus musculus


Alignment Length:36 Identity:9/36 - (25%)
Similarity:17/36 - (47%) Gaps:2/36 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VHLGK--YGAREEFFPQKASVWALKSNDAYGDSNNN 53
            ||.|:  :...::|..:...|.|.:..|.|..:.|:
Mouse   333 VHAGRQTFQRFDKFNAKYNPVGASELRDLYMKTENH 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396
Car10NP_082572.1 alpha_CARP_X_XI_like 46..302 CDD:239395
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.