DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and CA10

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001076002.1 Gene:CA10 / 56934 HGNCID:1369 Length:328 Species:Homo sapiens


Alignment Length:292 Identity:76/292 - (26%)
Similarity:126/292 - (43%) Gaps:55/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RGSPESYNYDWD-----QG-----PHTW---DTACN------NQSPINIDMNCVEINYFDTPLIW 121
            :.||:.:...|.     ||     |..|   ::|.|      .|||:||:.:.:..:.|.|||  
Human    23 QNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPL-- 85

  Fly   122 SHYNSIPLGIR-----LENNGHTLILRAAFPERTPSIDGGDLLGRFDFREISFRWSWASSLGSEH 181
                .|..|.|     :.|.|..:.||.. .|...:|.||.:.......||...:....|.||||
Human    86 ----RINTGGRKVSGTMYNTGRHVSLRLD-KEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEH 145

  Fly   182 TLDHHHSPLEMQCLHTDGD----GCDGCSSSQGVLMISYMFDLSE-HNPFLDVLIQHLAAVEQAG 241
            .|:......|:|.:|.:.:    ..:...|..|::::|....:|: .||||:.::..       .
Human   146 LLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR-------D 203

  Fly   242 QVVEVPPFPLSYLMS--------PFYDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEFR 298
            .:..:.....:||:.        |....|.:|:||:|.|||:..|.|:|..:.:.|:..|::..|
Human   204 TITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLR 268

  Fly   299 QLRDRRGSRI----ARNARPVQPIGDRMVYLN 326
            .|...:.|:|    :.|.|||||:.:|.:..|
Human   269 LLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 73/283 (26%)
CA10NP_001076002.1 alpha_CARP_X_XI_like 46..302 CDD:239395 71/269 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145776
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.