DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and ptprga

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001316793.1 Gene:ptprga / 561197 ZFINID:ZDB-GENE-101101-4 Length:1414 Species:Danio rerio


Alignment Length:286 Identity:84/286 - (29%)
Similarity:129/286 - (45%) Gaps:44/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GDNCRRLRGSPESY-NYDWDQGPHT-WDTA---C--NNQSPINI-DMNC-VEINY-------FDT 117
            ||  |..|.:.||| .|....||.| |..|   |  .||||||| |.:. |.:.|       ||.
Zfish    47 GD--RHRRAAEESYWAYSGTYGPDTGWAAAFPECQERNQSPINIADQDTKVSMEYQELTLDGFDA 109

  Fly   118 PLIWSHYNSIPLGIRLENNGHTLILRAAFPERTPSIDGGDLLGRFDFREISFRWSWAS-SLGSEH 181
            ..  |:..|      ::|.|.|:   |.|.:....:.|..|.|||...::.|.|..:: |.||||
Zfish   110 ES--SNKTS------MKNTGKTV---AIFLKDDYFVRGAGLPGRFKAEKVEFHWGQSNGSDGSEH 163

  Fly   182 TLDHHHSPLEMQCLHTDGDGCDGCSSS------QGVLMISYMFDLSEHNPFLDVLIQHLAAVEQA 240
            :::....|:|||....:.|..|..:::      ...:.:.:..|..: ||.:|.:|..|..|...
Zfish   164 SINGRRFPVEMQIFMYNSDDFDSLNTAIREKRVIAAMAVFFQVDFKD-NPAVDPIIHGLRGVVHH 227

  Fly   241 GQVVEVPPFPLSYLMSPFYDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEF-------R 298
            .:...:.||.|..|:......:|.|.||||.|||.:..||:::...:.:|.:||..|       :
Zfish   228 EKETFLEPFVLRDLLPSSIGSYYRYIGSLTTPPCSKVVEWIVFSRPVLLSYKQLEAFYSIFTTEQ 292

  Fly   299 QLRDRRGSRIARNARPVQPIGDRMVY 324
            |...:....:..|.||:|.:.:|.|:
Zfish   293 QDHVKSVEYLRNNFRPLQSLDNREVF 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 78/273 (29%)
ptprgaNP_001316793.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.